Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days.
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human S100P protein
Catalog Number orb49620
Species/HostE. coli
ReactivityHuman
ConjugationUnconjugated
Tested applicationsSDS-PAGE
Endotoxins Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Target S100P
Alternative Names
Product Properties
Form/Appearance Liquid: Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 0.1M NaCl, 20% Glycerol, pH 8.0 .
Storage Store at -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Note For research use only.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Protein Sequence MGSSHHHHHHSSGLVPRGSHMTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Purity >95% as determined by reducing SDS-PAGE.
MW 12.56 kDa
Source E. coli
Uniprot ID P25815
Product Description

Human S100P protein

Application Notes
Application Notes 6His tag at the N-terminus.
Reviews
Write Your Own Review
You're reviewing:Human S100P protein - orb49620
Your Rating