Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human Hemopexin protein
Catalog Number orb419974
ReactivityHuman
ConjugationUnconjugated
Tested applicationsSDS-PAGE
Endotoxins Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Target Hemopexin
Product Properties
Form/Appearance Liquid from a 0.2 μm filtered solution of 20mM MES,150mM NaCl,pH5.5.
Storage Store at -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Note For research use only.
Protein Sequence TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTHHHHHHH
Purity >95% as determined by reducing SDS-PAGE.
MW 50.1kDa
Source Human Cells
Uniprot ID P02790
Product Description

Recombinant of human Hemopexin protein

Application Notes
Application Notes C-6His
Reviews
Write Your Own Review
You're reviewing:Human Hemopexin protein - orb419974
Your Rating