You have no items in your shopping cart.
Cart summary
HOXB7 Peptide - middlel region
Catalog Number: orb1997666
| Catalog Number | orb1997666 |
|---|---|
| Category | Proteins |
| Description | HOXB7 Peptide - middlel region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: LELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTS |
| UniProt ID | P09024 |
| MW | 24 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | Hox-2.3, AI325018 |
| Note | For research use only |
| NCBI | NP_034590.2 |
