You have no items in your shopping cart.
Cart summary
FCGR2B Peptide - middle region
Catalog Number: orb1998737
| Catalog Number | orb1998737 |
|---|---|
| Category | Proteins |
| Description | FCGR2B Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: GNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQT |
| UniProt ID | P31995 |
| MW | 35 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CD32, FCG2, CD32B, FCGR2, IGFR2, FCGR2C, FcRII-c |
| Note | For research use only |
| NCBI | NP_963857.3 |
