Cart summary

You have no items in your shopping cart.

CHPF Peptide - N-terminal region

CHPF Peptide - N-terminal region

Catalog Number: orb2001342

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001342
CategoryProteins
DescriptionCHPF Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: SVTWVEEPCGPGPPQPGDSELPPRGNTNAARRPNSVQPGAEREKPGAGEG
UniProt IDQ8IZ52
MW85 kDa
Tested applicationsWB
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCSS2, CHSY2
NoteFor research use only
NCBINP_001182660.1