You have no items in your shopping cart.
Cart summary
TLE1 Peptide - middle region
Catalog Number: orb1998060
| Catalog Number | orb1998060 |
|---|---|
| Category | Proteins |
| Description | TLE1 Peptide - middle region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 56 kDa |
| UniProt ID | Q62440 |
| Protein Sequence | Synthetic peptide located within the following region: VPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNE |
| NCBI | NP_001272459.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Grg1, Grg-1, Tle4l, Estm14, C230057C06Rik Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
