YAP1 Rabbit Polyclonal Antibody

• Catalog Number: orb581119
• Category: Antibodies
• Description: Rabbit polyclonal antibody to YAP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human YAP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: YAP1
• UniProt ID: P46937
• Protein Sequence: Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS
• NCBI: NP_001123617
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: YAP, YKI, COB1, YAP2, YAP65
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Fetal Liver lysates, Antibody dilution: 3 ug/ml.

Sample Type: Human Fetal Lung cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Positive control (+): HepG2 (HG), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.

Human Prostate

Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-YAP1 antibody (orb581119).

WB Suggested Anti-YAP1 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate.