You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TNMD |
| Target | TNMD |
| Protein Sequence | Synthetic peptide located within the following region: QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI |
| Molecular Weight | 37 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TNMD Rabbit Polyclonal Antibody [orb101154]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Porcine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlTNMD Rabbit Polyclonal Antibody [orb580820]
WB
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlTNMD Rabbit Polyclonal Antibody [orb612264]
WB
Mouse, Rat
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 39 kDa, 37 kDa and 30 kDa. The protein may also be phosphorylated and/or glycosylated.

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-TNMD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. TNMD is supported by BioGPS gene expression data to be expressed in 721_B.
Documents Download
Request a Document
TNMD Rabbit Polyclonal Antibody (orb580821)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



















