Cart summary

You have no items in your shopping cart.

SOX10 Rabbit Polyclonal Antibody

SKU: orb574604

Description

Rabbit polyclonal antibody to SOX10

Research Area

Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SOX10
TargetSOX10
Protein SequenceSynthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
Molecular Weight50 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DOM, WS4, PCWH, WS2E, WS4C

Similar Products

  • SOX10 Rabbit Polyclonal Antibody [orb500740]

    FC,  WB

    Bovine, Canine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SOX10 Rabbit Polyclonal Antibody [orb402212]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SOX10 Rabbit Polyclonal Antibody [orb1743816]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SOX10 Rabbit Polyclonal Antibody [orb631414]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SOX10 rabbit pAb Antibody [orb773855]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SOX10 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

SOX10 Rabbit Polyclonal Antibody

A/ [IHC-PZ] (optimal processing) human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 microns A2/ [IHC-PZ + FF] As above for initial fixation then post-fixed in 10% buffered formalin for 5 days B/ [IHC-P] human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 microns Controls Negative: omission of primary. Positive: Olig2 reactivity was in comparison with antibody used at 1:10000 (IHC-PZ); 1:4000 (IHC-P).

SOX10 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

SOX10 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

SOX10 Rabbit Polyclonal Antibody

Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

SOX10 Rabbit Polyclonal Antibody

Sample Type: Jurkat cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 4.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

SOX10 Rabbit Polyclonal Antibody

Positive control (+): Rat brain (R-BR), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/ml.

SOX10 Rabbit Polyclonal Antibody

SOX10 antibody - middle region (orb574604) validated by WB using Hek 293 Whole Cell Lysate at 1:4, 000.

SOX10 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

SOX10 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX10 Antibody Titration: 25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_008872

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SOX10 Rabbit Polyclonal Antibody (orb574604)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry