PAWR Rabbit Polyclonal Antibody

• Catalog Number: orb574359
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAWR
• Target: PAWR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAWR
• Protein Sequence: Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT
• UniProt ID: O75796
• MW: 37kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PAR4, Par-4
• Note: For research use only
• NCBI: NP_002574

Human kidney

Human Liver

WB Suggested Anti-PAWR Antibody Titration: 0.5-1.0 ug/ml, Positive Control: Jurkat cell lysate.