PAWR Rabbit Polyclonal Antibody

• Catalog Number: orb574032
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WT1
• Target: PAWR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Equine, Guinea pig, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAWR
• Protein Sequence: Synthetic peptide located within the following region: VNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLL
• UniProt ID: O75796
• MW: 37kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PAR4, Par-4
• Note: For research use only
• NCBI: NP_002574

Human Muscle

WB Suggested Anti-PAWR Antibody, Positive Control: Lane 1: 30 ug rat striatum homogenate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-PAWR Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.