MUC1 Rabbit Polyclonal Antibody

• Catalog Number: orb578068
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MUC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 22kDa
• Target: MUC1
• UniProt ID: Q7Z552
• Protein Sequence: Synthetic peptide located within the following region: GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL
• NCBI: NP_001037855
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HepG2 Whole cell lysates, Antibody Dilution: 1.0 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

NMuFG cells in ImmunohistochemistryDilutions 1:50 for the three primary antibodies and 1:100 for FITC-conjugated secondary.

Rabbit Anti-MUC1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: Human stomach, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.

Sample Type: Pig stomach, Primary Antibody Dilution: 1:5000 + 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.

Sample Type: Pig stomach, Primary Antibody Dilution: 1:5000 + 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.