You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, FC, ICC, IF, WB |
|---|---|
| Dilution Range | WB:1:10,000-1:30,000, IF:1:200-1:1,000, ELISA:1:20,000-1:50,000, FC: 2 ug/test |
| Reactivity | Other |
| Application Notes |
Key Properties
−| Host | Gallus |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgY |
| Immunogen | Antigen: Affinity purified recombinant Red Fluorescent Protein (mCherry). Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK |
| Target | Red Fluorescent Protein |
| Molecular Weight | 27 kDa |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. Affinity purified using the immunogen immobilized on a solid support; Sample purity >95% (SDS-PAGE). |
| Concentration | 2 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of 293T-mCherry cells using mCherry Chicken polyclonal antibody orb611194 with dilution at 1:10000.

Immunofluorescent analysis of 293T-mCherry cells using mCherry Chicken polyclonal antibody orb611194 with dilution at 1:200.

Immunofluorescent analysis of 293T-mCherry cells using mCherry Chicken polyclonal antibody orb611194 with dilution at 1:200.

Immunofluorescent analysis of 293T-mCherry cells using mCherry Chicken polyclonal antibody orb611194 with dilution at 1:200.

Immunofluorescent analysis of 293T-mCherry cells using mCherry Chicken polyclonal antibody orb611194 with dilution at 1:200.

Immunofluorescent analysis of 293T-mCherry cells using mCherry Chicken polyclonal antibody orb611194 with dilution at 1:200.

Immunofluorescent analysis of 293T-mCherry cells using mCherry Chicken polyclonal antibody orb611194 with dilution at 1:200.

Flow Cytometry analysis of 293t-mCherry cells (1x10^5 cells) using orb611194 mCherry Chicken polyclonal antibody with 2ug /test (green), blank (grey), isotype control (blue).
Quick Database Links
Documents Download
Request a Document
Protocol Information
mCherry Chicken Polyclonal Antibody (orb611194)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review