Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KPNB1 Rabbit Polyclonal Antibody

SKU: orb331124

Description

KPNB1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting KPNB1. It is suitable for WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics, Infectious Diseases

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetKPNB1
Protein SequenceSynthetic peptide located within the following region: EHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLA
Molecular Weight96kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti IMB1 antibody, anti IPO1 antibody, anti IPOB antibody, anti Impnb antibody, anti MGC2155 antibody, anti MGC2156 antibody, anti MGC2157 antibody, anti NTF97 antibody

Similar Products

  • KPNB1 Antibody (N-term) [orb1929784]

    FC,  IHC-P,  WB

    Mouse, Other, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • KPNB1 Rabbit Polyclonal Antibody [orb865428]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • KPNB1 Rabbit Polyclonal Antibody [orb395192]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • KPNB1 Rabbit Polyclonal Antibody [orb77176]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NTF97 Rabbit Polyclonal Antibody (FITC) [orb8744]

    IF

    Bovine, Equine, Gallus, Human, Mouse, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KPNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-KPNB1 Antibody, Positive Control: Lane 1: 80 ug mouse brain extract, Lane 2: 80 ug rat brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.

KPNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-KPNB1 Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell, There is BioGPS gene expression data showing that KPNB1 is expressed in ACHN.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002256

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

KPNB1 Rabbit Polyclonal Antibody (orb331124)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry