You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human ZG16B protein
Catalog Number: orb358657
| Catalog Number | orb358657 |
|---|---|
| Category | Proteins |
| Description | Recombinant human ZG16B protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q96DA0 |
| MW | 21.2 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 53-208aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | ZG16B, UNQ773/PRO1567Zymogen granule protein 16 ho Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human ZG16B protein [orb358798]
Greater than 90% as determined by SDS-PAGE.
19.2 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 3
Human ZG16B Protein [orb1477835]
Greater than 95% as determined by SDS-PAGE.
20.0 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
Human ZG16B Protein [orb1476838]
Greater than 90% as determined by SDS-PAGE.
20.0 kDa
Mammalian cell
1 mg, 20 μg, 100 μg 
- Item 1 of 1
Human Zymogen Granule Protein 16 Homolog B (ZG16B) ELISA Kit [orb780221]
Human
0.32-20 ng/mL
0.13 ng/mL
96 T, 48 T
