You have no items in your shopping cart.
Human ZG16B Protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC50 is 24.13-46.04 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 20.0 kDa |
| Expression Region | 53-208aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human Zymogen Granule Protein 16 Homolog B (ZG16B) ELISA Kit [orb780221]
Human
0.32-20 ng/mL
0.13 ng/mL
96 T, 48 THuman ZG16B protein [orb358798]
Greater than 90% as determined by SDS-PAGE.
19.2 kDa
Yeast
20 μg, 1 mg, 100 μgHuman ZG16B protein [orb358657]
Greater than 90% as determined by SDS-PAGE.
21.2 kDa
E.coli
20 μg, 100 μg, 1 mgZG16B Rabbit Polyclonal Antibody [orb2954711]
ELISA, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/ml can bind Anti-ZG16B recombinant antibody, the EC50 is 24.13-46.04 ng/mL.

The purity of ZG16B was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human ZG16B Protein (orb1477835)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





