You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CHRNA1 Protein
Catalog Number: orb1477210
| Catalog Number | orb1477210 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL |
| Protein Length | Partial of P02708-1 |
| UniProt ID | P02708 |
| MW | 32.7 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Not test. |
| Source | Baculovirus |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 21-255aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | ACHRA (CHNRA) |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human CHRNA1 protein [orb244109]
Greater than 90% as determined by SDS-PAGE.
31.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human CHRNA1 protein [orb419043]
Greater than 90% as determined by SDS-PAGE.
44.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human CHRNA1 protein [orb624124]
Greater than 85% as determined by SDS-PAGE.
86.0 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human Nicotinic Acetylcholine Receptor alpha 1 protein [orb753825]
ELISA, WB
Greater than 90% as determined by SDS-PAGE
47.7 kDa
E.Coli
1 mg, 50 μg, 200 μg, 100 μg 
Recombinant Human CHRNA1 Protein, N-His [orb2833393]
> 90% as determined by SDS-PAGE.
29.46 kDa
100 μg, 50 μg, 20 μg
