You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human CD8A protein
Catalog Number: orb358796
| Catalog Number | orb358796 |
|---|---|
| Category | Proteins |
| Description | Recombinant human CD8A protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
| Protein Length | Extracellular Domain |
| UniProt ID | P01732 |
| MW | 19.6 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 22-182aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | T-lymphocyte differentiation antigen T8/Leu-2 CD_a Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD8A.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD8A.
- Item 1 of 3
Human CD8A protein [orb358935]
Greater than 90% as determined by SDS-PAGE.
21.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 2
Human CD8A Protein, hFc Tag [orb1291098]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.23 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human CD8A protein [orb358453]
Greater than 90% as determined by SDS-PAGE.
33.6 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
- Item 1 of 1
