You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human ACVR2B protein
Catalog Number: orb594924
| Catalog Number | orb594924 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Activin receptor type-2B(ACVR2B),partial (Active) |
| Tag | C-terminal 6xHis-Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 10% Trehalose, 3% Mannitol, 0.05% Tween 80, 10 mM Methionine, pH 8.5. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT |
| Protein Length | Partial |
| UniProt ID | Q13705 |
| MW | 41.3 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human Activin A at 2μg/ml can bind Human ACVR2B-Fc-His, the ED50 of Recombinant Human ACVR2B-Fc-His is 50-500 ng/ml. |
| Expression Region | 19-134aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Activin Receptor Type-2B; Activin Receptor Type II Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human ACVR2B protein [orb358334]
Greater than 90% as determined by SDS-PAGE.
15.7 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
Human ACVR2B protein [orb604918]
Greater than 85% as determined by SDS-PAGE.
27.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse ACVR2B Protein, hFc Tag [orb2321223]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.8 kDa after removal of the signal peptide. The apparent molecular mass of mACVR2B-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human ACVR2B Protein, mFc Tag [orb2321461]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.9 kDa after removal of the signal peptide. The apparent molecular mass of ACVR2B-mFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human ACVR2B Protein, hFc Tag [orb2321328]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.8 kDa after removal of the signal peptide. The apparent molecular mass of ACVR2B-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
