You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb583768 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to HNF1A |
| Target | HNF1A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A |
| Protein Sequence | Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
| UniProt ID | P20823 |
| MW | 67kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDD Read more... |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_000536 |

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Stomach, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Liver Carcinoma (HepG2 lysate) 10-40 ug lysate/lane, Primary dilution: 1:1000, Secondary: Alexa Fluor 680 Donkey Anti-Rabbit IgG Invitrogen, Secondary dilution: 1:30000. HNF1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

WB Suggested Anti-HNF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human kidney.
IF, IHC-Fr, IHC-P | |
Bovine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Porcine, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Equine, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review