Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EGR1 Rabbit Polyclonal Antibody

SKU: orb574097

Description

Rabbit polyclonal antibody to EGR1

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Equine, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EGR1
TargetEGR1
Protein SequenceSynthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
Molecular Weight58 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268

Similar Products

  • Egr1 Rabbit Polyclonal Antibody [orb10586]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • EGR1 Antibody (N-term) [orb34304]

    FC,  IF,  WB

    Other

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • EGR1 Rabbit Polyclonal Antibody [orb1145818]

    ELISA,  FC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Egr1 Rabbit Polyclonal Antibody [orb576117]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep

    Frog, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • EGR1 Rabbit Polyclonal Antibody [orb576118]

    IHC,  WB

    Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep

    Frog, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EGR1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

EGR1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

EGR1 Rabbit Polyclonal Antibody

Immunohistochemistry with Colon, myenteric plexus tissue at an antibody concentration of 5.0 ug/ml using anti-EGR1 antibody (orb574097).

EGR1 Rabbit Polyclonal Antibody

Rabbit Anti-EGR1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

EGR1 Rabbit Polyclonal Antibody

Rabbit Anti-EGR1 Antibody, Paraffin Embedded Tissue: Human Spleen, Cellular Data: Spleen cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

EGR1 Rabbit Polyclonal Antibody

WB Suggested Anti-EGR1 Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001955

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

EGR1 Rabbit Polyclonal Antibody (orb574097)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry