Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CD63 Antibody

SKU: orb11597

Description

CD63 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of the members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIF, IHC-Fr, IHC-P, WB
Dilution RangeWB:1:500-1:5,000, IF:1:25-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
ReactivityCanine, Human, Monkey, Mouse, Rat
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. Antigen Sequence: MENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCI
TargetLysosome-associated membrane glycoprotein 3
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CD63 antigen, CD63 antigen (melanoma 1 antigen), granulophysin, LAMP-3, lysosomal-associated membrane protein 3, lysosome-associated membrane glycoprotein 3, ME491, melanoma-associated antigen, melanoma 1 antigen, melanoma-associated antigen ME491, MLA1, ocular melanoma-associated antigen, OMA81H, tetraspanin-30, TSPAN30 antibody.

Similar Products

  • CD63 Antibody / LAMP-3 [orb2637615]

    FACS,  IF,  IHC-P,  WB

    Human, Mouse

    Mouse

    Monoclonal

    Unconjugated

    100 μg
  • CD63 Antibody / LAMP-3 [orb749338]

    FACS,  IF,  IHC-P,  WB

    Human, Mouse

    Mouse

    Monoclonal

    Unconjugated

    100 μg, 20 μg
  • CD63 Rabbit Polyclonal Antibody [orb11317]

    ELISA,  IHC-P,  WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CD63 Antibody [orb388930]

    FC,  IF,  IHC,  WB

    Human

    Mouse

    Monoclonal

    Unconjugated

    20 μg, 100 μg, 100 μg (without BSA and Azide)
  • CD63 Rabbit Polyclonal Antibody [orb1294289]

    FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 25 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CD63 Antibody

Anti-CD63 Ab at 1/2,500 dilution; lysate at 50 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

CD63 Antibody

IHC of mouse spleen using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

CD63 Antibody

Immunofluorescence – anti-CD63 Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with 4% of PFA.

CD63 Antibody

IHC of human pancreas using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

CD63 Antibody

Anti-CD63 Ab at 1/2,500 dilution; lysate at 50 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

CD63 Antibody

IHC of human cervix using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

CD63 Antibody

Immunofluorescence – anti-CD63 Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with 4% of PFA.

CD63 Antibody

IHC of rat eye using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IHC-Fr
Immunohistochemistry Frozen
View Protocol
IF
Immunofluorescence
View Protocol

CD63 Antibody (orb11597)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

Instock
In stock
Bulk Enquiry