Cart summary

You have no items in your shopping cart.

CALB1 Rabbit Polyclonal Antibody

SKU: orb326328

Description

Rabbit polyclonal antibody to CALB1

Research Area

Neuroscience

Images & Validation

Tested ApplicationsIHC, WB
ReactivityFrog, Human
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CALB1
TargetCALB1
Protein SequenceSynthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM
Molecular Weight30kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CALB antibody

Similar Products

  • CALB1 Rabbit Polyclonal Antibody [orb182649]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Calbindin/CALB1 Rabbit Polyclonal Antibody [orb182377]

    IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Calbindin/CALB1 Rabbit Polyclonal Antibody [orb443152]

    ELISA,  FC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CALB1 Rabbit Polyclonal Antibody [orb5912]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Calbindin D28K rabbit pAb Antibody [orb766814]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CALB1 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Tadpole tegmenta horizontal section, Primary antibody Dilution: 1:500, Secondary antibody: Donkey anti-rabbit Alexa 488, Secondary antibody Dilution: 1:500.

CALB1 Rabbit Polyclonal Antibody

CALB1 antibody - C-terminal region (orb326328) validated by WB using COLO205 cells lysate at 1 ug/mL.

CALB1 Rabbit Polyclonal Antibody

CALB1 Antibody (orb326328) tested in Purkinje neurons in human cerebellum> Calbindin 1 was detected using HRP/DAB brown color stain.

CALB1 Rabbit Polyclonal Antibody

Primary Antibody Dilution: 1:500, Secondary Antibody: Donkey anti-rabbit Alexa 488, Secondary Antibody Dilution: 1:500, Gene Name: CALB1.

CALB1 Rabbit Polyclonal Antibody

Primary Antibody Dilution: 1:500, Secondary Antibody: Donkey anti-rabbit Alexa 488, Secondary Antibody Dilution: 1:500, Gene Name: CALB1.

CALB1 Rabbit Polyclonal Antibody

Species+tissue/cell type: Tadpole forebrain horizontal section, Primary antibody Dilution: 1:500, Secondary antibody: Donkey anti-rabbit Alexa 488, Secondary antibody Dilution: 1:500.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004920

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CALB1 Rabbit Polyclonal Antibody (orb326328)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry