ACTN4 Rabbit Polyclonal Antibody

• Catalog Number: orb578375
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACTN4
• Target: ACTN4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACTN4
• Protein Sequence: Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI
• UniProt ID: O43707
• MW: 105kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FSGS, FSGS1, ACTININ-4
• Note: For research use only
• NCBI: NP_004915

Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: ACTN4.

WB Suggested Anti-ACTN4 Antibody Titration: 0.2-1 ug/ml, Positive Control: HCT116 cell lysate. ACTN4 is supported by BioGPS gene expression data to be expressed in HCT116.