You have no items in your shopping cart.
ZBTB32 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB32 |
| Target | ZBTB32 |
| Protein Sequence | Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL |
| Molecular Weight | 33 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ZBTB32 Rabbit Polyclonal Antibody (HRP) [orb2142219]
WB
Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μlZBTB32 Rabbit Polyclonal Antibody (Biotin) [orb2142217]
WB
Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μlZBTB32 Rabbit Polyclonal Antibody (FITC) [orb2142221]
WB
Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μlTZFP/ZNF538 Polyclonal Antibody [orb1416804]
ELISA, ICC, IF, IHC-Fr, IHC-P
Feline, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. ZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: HepG2 cell lysate.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
ZBTB32 Rabbit Polyclonal Antibody (orb573940)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
