USP36 Rabbit Polyclonal Antibody

• Catalog Number: orb583657
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USP36
• Target: USP36
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USP36
• Protein Sequence: Synthetic peptide located within the following region: SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
• UniProt ID: Q9P275
• MW: 123 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DUB1
• Note: For research use only
• NCBI: NP_079366

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is modified by phosphorylation.

Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 3 ug/ml.

WB Suggested Anti-USP36 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.