You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2008264 |
---|---|
Category | Proteins |
Description | UBE2T,ubiquitin-conjugating enzyme E2T (putative),PIG50; HSPC150; UBE2T,ubiquitin-conjugating enzyme E2 T,ubiquitin-conjugating enzyme E2 T,ubiquitin-protein ligase T,ubiquitin carrier protein T,ubiquitin conjugating enzyme,cell proliferation-inducing gene 50 protein,HSPC150 protein similar to ubiquitin-conjugating enzyme |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGV |
UniProt ID | Q9NPD8 |
MW | 22kDa |
Tested applications | WB |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | HSPC150, PIG50 |
Note | For research use only |
NCBI | NP_054895 |