You have no items in your shopping cart.
Cart summary
Ube2g1 Peptide - N-terminal region
Catalog Number: orb2008551
| Catalog Number | orb2008551 |
|---|---|
| Category | Proteins |
| Description | Ube2g1 Peptide - N-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | GPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISI |
| UniProt ID | P62254 |
| MW | 19kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with Ube2g1 Rabbit Polyclonal Antibody (orb578684). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | 2700059C12Rik, AI256795, AU014992, AW552068, D1300 Read more... |
| Note | For research use only |
| NCBI | NP_080261 |
