You have no items in your shopping cart.
Cart summary
UBE2G1 Peptide - middle region
Catalog Number: orb2000443
| Catalog Number | orb2000443 |
|---|---|
| Category | Proteins |
| Description | UBE2G1 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: RPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTV |
| UniProt ID | P62253 |
| MW | 20 kDa |
| Application notes | This is a synthetic peptide designed for use in combination with UBE2G1 Rabbit Polyclonal Antibody (orb588696). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | UBC7, E217K, UBE2G |
| Note | For research use only |
| NCBI | NP_003333.1 |
