You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578681 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to UBE2D3 |
| Target | UBE2D3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2D3 |
| Protein Sequence | Synthetic peptide located within the following region: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF |
| UniProt ID | P61077 |
| MW | 17kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | UBC4/5, UBCH5C, E2(17)KB3 |
| Research Area | Molecular Biology, Protein Biochemistry |
| Note | For research use only |
| NCBI | NP_003331 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Lanes: 1: 40 ng HIS-UBE2D1 protein, 2: 40 ng HIS-UBE2D2 protein, 3: 40 ng HIS-UBE2D3 protein, 4: 40 ng HIS-UBE2D4 protein, 5: 40 ng HIS-UBE2E1 protein, 6: 40 ng HIS-UBE2E2 protein, 7: 40 ng HIS-UBE2E3 protein, 8: 40 ng HIS-UBE2K protein, 9: 40 ng HIS-UBE2L3 protein, 10: 40 ng HIS-UBE2N protein, 11: 40 ng HIS-UBE2V1 protein, 12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:50000, Gene Name: UBE2D3.

WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
PE |
IF | |
Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Cy3 |
IF | |
Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review