You have no items in your shopping cart.
Transthyretin (F87M/L110M) , Human, Recombinant
SKU: orb1401961
Description
Images & Validation
−
Key Properties
−| Source | Protein expressed in Escherichia coli |
|---|---|
| Molecular Weight | 13.7 kDa |
| Protein Sequence | GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE |
| Purity | 95% by Chromatography and SDS-PAGE |
Storage & Handling
−| Storage | Room temperature, avoid light exposure. |
|---|---|
| Form/Appearance | Lyophilized 1 mg/vial |
| Buffer/Preservatives | The lyophilized protein is readily soluble in PBS pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Transthyretin (F87M/L110M) , Human, Recombinant (orb1401961)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review