TNNI2 Rabbit Polyclonal Antibody

• Catalog Number: orb581328
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Cystatin C
• Target: TNNI2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNNI2
• Protein Sequence: Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
• UniProt ID: P48788
• MW: 21 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DA2B, FSSV, DA2B1, fsTnI, AMCD2B
• Note: For research use only
• NCBI: NP_003273

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Peptide sequence migrates higher than 21 kDa canonical isoform (~25 kDa) and is modified by phosphorylation in some samples.

WB Suggested Anti-TNNI2 Antibody Titration: 1.25 ug/ml, Positive Control: Human Muscle.