You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581328 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Cystatin C |
Target | TNNI2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TNNI2 |
Protein Sequence | Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL |
UniProt ID | P48788 |
MW | 21 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DA2B, FSSV, DA2B1, fsTnI, AMCD2B |
Note | For research use only |
NCBI | NP_003273 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Peptide sequence migrates higher than 21 kDa canonical isoform (~25 kDa) and is modified by phosphorylation in some samples.
WB Suggested Anti-TNNI2 Antibody Titration: 1.25 ug/ml, Positive Control: Human Muscle.
IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |