Cart summary

You have no items in your shopping cart.

TGFBR2 Rabbit Polyclonal Antibody

SKU: orb333717

Description

Rabbit polyclonal antibody to TGF beta Receptor 2

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Goat, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TGFBR2
TargetTGFBR2
Protein SequenceSynthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Molecular Weight65 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-AAT3 antibody, anti-FAA3 antibody, anti-LDS1B antibody, anti-LDS2 antibody, anti-LDS2B antibody, anti-MFS2 antibody, anti-RIIC antibody, anti-TAAD2 antibody, anti-TbetaR II antibody, anti-TbetaR-II antibody, anti-TGF beta receptor type 2 antibody, anti-TGF beta receptor type IIB antibody, anti-TGF beta type II receptor antibody, anti-TGF-beta receptor type II antibody, anti-TGF-beta receptor type-2 antibody, anti-TGF-beta type II receptor antibody, anti-TGF-beta-R2 antibody, anti-TGFB R2 antibody, anti-TGFbeta - RII antibody, anti-TGFbeta RII antibody, anti-Tgfbr2 antibody, anti-TGFR-2 antibody, anti-TGFR2_HUMAN antibody, anti-HNPCC6 antibody, anti-TGF-beta receptor type IIB antibody, anti-TGFbeta-RII antibody, anti-transforming growth factor beta receptor type IIC antibody, anti-Transforming growth factor-beta receptor type II antibody

Similar Products

  • TGF beta Receptor II Rabbit Polyclonal Antibody [orb500790]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • TGFβ RII Polyclonal Antibody [orb1411974]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Phospho-TGF beta Receptor II (Ser225) Rabbit Polyclonal Antibody [orb317990]

    WB

    Canine, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TGFBR2 Rabbit Polyclonal Antibody [orb214665]

    IHC,  WB

    Human, Monkey

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 30 μl, 100 μl, 50 μl
  • TGFBR2 Antibody [orb675901]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TGFBR2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at 50 kDa and 32 kDa.

TGFBR2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

TGFBR2 Rabbit Polyclonal Antibody

WB Suggested Anti-TGFBR2 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate, TGFBR2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003233

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TGFBR2 Rabbit Polyclonal Antibody (orb333717)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry