SNX1 Rabbit Polyclonal Antibody

• Catalog Number: orb331258
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNX1
• Target: SNX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: EDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADAT
• UniProt ID: Q13596
• MW: 63kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti HsT17379 antibody, anti MGC8664 antibody, ant
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_001229862
• Expiration Date: 12 months from date of receipt.

Human, Mouse

Rabbit Anti-SNX1 Antibody, Catalog Number: orb331258, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in vesicles, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SNX1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell, SNX1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.