You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb331258 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SNX1 |
| Target | SNX1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: EDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADAT |
| UniProt ID | Q13596 |
| MW | 63kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti HsT17379 antibody, anti MGC8664 antibody, ant Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin, Molecular B Read more... |
| Note | For research use only |
| NCBI | NP_001229862 |
| Expiration Date | 12 months from date of receipt. |

Human, Mouse

Rabbit Anti-SNX1 Antibody, Catalog Number: orb331258, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in vesicles, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SNX1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell, SNX1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review