You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579522 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Rorb |
Target | Rorb |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: MSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSS |
UniProt ID | Q8R1B8 |
MW | 41kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | hs, Nr1, Ror, RZRB, hstp, Nr1f2, RZR-b, Rorbeta, R Read more... |
Note | For research use only |
NCBI | AAH24842 |
WB Suggested Anti-Rorb Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Brain.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Human, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |