Reptile TLF1 protein

• Catalog Number: orb604721
• Category: Proteins
• Description: Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin(TLF1)
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP
• Protein Length: Full Length of Mature Protein
• UniProt ID: P05620
• MW: 33.1 kDa
• Application notes: Full Length of Mature Protein
• Source: E.coli
• Biological Origin: Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)
• Expression Region: 25-260aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Fibrinogen-clotting enzyme (Habutobin) (Snake veno
• Research Area: Epigenetics
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) TLF1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) TLF1.