You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1494681 |
|---|---|
| Category | Proteins |
| Description | MIP-1 Alpha, also known as CCL3, G0S19-1 and SCYA3, is a small inducible monokine belonging to the intercrine beta (chemokine CC) family. It binds to CCR1, CCR4 and CCR5, and participates in the host response to invading pathogens by regulating the trafficking and activation of inflammatory cells, such as macrophages, lymphocytes, NK cells and dendritic cells. MIP-1 alpha polymorphisms are associated with HIV susceptibility or resistance. Recombinant MIP-1 alpha induces a dose-dependent inhibition of HIV and SIV infection. |
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
| Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
| Protein Sequence | ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| MW | 8-10 kDa, observed by reducing SDS-PAGE. |
| Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Source | CHO |
| Biological Activity | ED50 < 100 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells expressing CCR5. |
| Storage | Lyophilized recombinant Human MIP-1 Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1 Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
| Alternative names | MIP1α; Macrophage Inflammatory Protein-1α, CCL3, L Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review