Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20)-VLPs (Active)

• Catalog Number: orb2658865
• Category: Proteins
• Description: Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20)-VLPs (Active)
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Form/Appearance: Lyophilized powder
• Purity: The purity information is not available for VLPs proteins.
• MW: 40.2 kDa
• UniProt ID: XP_015310747.1
• Protein Sequence: MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHASLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHRGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
• Protein Length: Full Length
• Source: Mammalian cell
• Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 3.549 - 6.542 ng/mL.The VLPs (CSB-MP3838) is negative control.
• Expression Region: 1-359aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
• Expiration Date: 6 months from date of receipt.

Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/ml can bind Anti-GPR20 recombinant antibody. The EC50 is 3.549 - 6.542 ng/mL.The VLPs is negative control.

The purity of VLPs was greater than 95% as determined by SEC-HPLC