You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial (Active)
Catalog Number: orb1096687
| Catalog Number | orb1096687 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial (Active) |
| Tag | C-terminal mFc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 54.4 kDa |
| UniProt ID | P0DTC2 |
| Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml. |
| Expression Region | 319-541aa(E484K) |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Alternative names | / Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml.
