You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1785019 |
---|---|
Category | Proteins |
Description | Recombinant Human Delta-like protein 3 (DLL3), partial (Active) |
Tag | C-terminal mFc-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
Protein Length | Partial |
UniProt ID | Q9NYJ7 |
MW | 36.0 kDa |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.211-7.209 ng/mL. |
Expression Region | 429-492aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Alternative names | Delta-like protein 3; Drosophila Delta homolog 3 ( Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/ml can bind Anti-DLL3 recombinant antibody. The EC50 is 6.211-7.209 ng/mL.
Greater than 95% as determined by SDS-PAGE. | |
11.7 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
39.7 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
8.1 kDa | |
Mammalian cell |
Greater than 71.6% as determined by SDS-PAGE. | |
51.5 kDa | |
Mammalian cell |