You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1095906 |
---|---|
Category | Proteins |
Description | Recombinant Human Cytotoxic T-lymphocyte protein 4(CTLA4),partial (Active) |
Tag | C-terminal hFc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 91% as determined by SDS-PAGE. |
MW | 42.5 kDa |
UniProt ID | P16410 |
Protein Sequence | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody, the EC50 of human CD152 protein is 27.14-34.82 ng/ml. |
Expression Region | 37-162aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
Alternative names | Cytotoxic T-lymphocyte-associated antigen 4 (CTLA- Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody, the EC50 of human CD152 protein is 27.14-34.82 ng/ml.
The purity of CTLA4 was greater than 90% as determined by SEC-HPLC.