Recombinant Human Cystine/glutamate transporter (SLC7A11) (Active)

• Catalog Number: orb1096292
• Category: Proteins
• Description: Recombinant Human Cystine/glutamate transporter(SLC7A11)
• Tag: N-terminal 10xHis-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
• Protein Length: Full Length
• UniProt ID: Q9UPY5
• MW: 58.2 kDa
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Source: in vitro E.coli expression system
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2 μg/mL can bind Anti-SLC7A11 recombinant antibody, the EC50 is 9.452-13.79 ng/mL.
• Expression Region: 1-501aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Amino acid transport system xc- (Calcium channel b
• Research Area: Cell Biology
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2μg/mL can bind Anti-SLC7A11 recombinant antibody, the EC50 is 9.452-13.79 ng/mL.

Loaded Anti-Human SLC7A11 Antibody on 96-Flat plate, can bind Human SLC7A11, with an affinity constant of ＜1 pM as determined in BLI assay (Gator Prime).