PDPN Rabbit Polyclonal Antibody

SKU: orb330388

Description

Rabbit polyclonal antibody to PDPN

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDPN
• Target: PDPN
• Protein Sequence: Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
• Molecular Weight: 24 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti GP36 antibody, anti GP40 antibody, anti Gp38 antibody, anti HT1A-1 antibody, anti OTS8 antibody, anti PA2.26 antibody, anti T1A antibody, anti T1A-2 antibody, anti AGGRUS antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Peptide is present in multiple protein isoforms, including the canonical 17 kDa protein, as well as a 24 kDa protein and the protein may be heavily glycosylated.

Human Lung

WB Suggested Anti-PDPN Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

PDPN

UniProt

Q86YL7

RefSeq (Protein):NP_006465