You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb594835 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-4(Il4),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
| Protein Length | Partial |
| UniProt ID | P07750 |
| MW | 13.4 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.01 ng/ml. |
| Expression Region | 23-140aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-4;B-cell IgG differentiation factor;B- Read more... |
| Background | Mouse Interleukin-4(IL-4) is a monomeric, Th2 cyto Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
13.5 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
14.6 kDa | |
Mammalian cell |
Unconjugated | |
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. | |
Predicted: 50.2 KDa. Observed: 65-86 KDa, reducing conditions |
>95% as determined by SDS-PAGE | |
21 kDa |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review