KLK6 Rabbit Polyclonal Antibody

• Catalog Number: orb574868
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KLK6
• Target: KLK6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLK6
• Protein Sequence: Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
• UniProt ID: Q92876
• MW: 25kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: hK6, Bssp, Klk7, SP59, PRSS9, PRSS18
• Research Area: Epigenetics & Chromatin, Molecular Biology, Pharma
• Note: For research use only
• NCBI: NP_001012982
• Expiration Date: 12 months from date of receipt.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Lung

WB Suggested Anti-KLK6 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.