You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Assay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 7 IU/mg. Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 x 10 ^ 6 IU/mg. |
| Tag | Tag-Free |
| Expression Region | 30-212aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 20.7 kDa |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Interleukin-6 (IL6) Protein (Active) [orb1881858]
Greater than 95% as determined by SDS-PAGE
22.8 kDa
Yeast
1 mg, 100 μg, 20 μgRecombinant human IL-6 protein (Active, HEK293) [orb1817202]
>95% as determined by SDS-PAGE
26-30 kDa
10 μg, 50 μg, 500 μgRecombinantIL-6,Human [orb1494814]
> 95% by SDS-PAGE analysis.
20.9 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μgRecombinant human IL-6 protein (Active, CHO) [orb3124196]
≥ 95% as determined by SDS-PAGE.
20.8 kDa
10 μg, 50 μg, 500 μgRecombinant Human Interleukin-6 protein(IL6) (Active) [orb1650622]
>96% as determined by SDS-PAGE and HPLC.
20.7 kDa
1 mg, 500 μg, 250 μg, 100 μg, 20 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SDS-PAGE gel analysis of orb358972.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human IL6 protein (Active) (orb358972)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


