Cart summary

You have no items in your shopping cart.

Human IL6 protein (Active)

Catalog Number: orb358972

Select Product Size
SizePriceQuantity
5 μg$ 210.00
100 μg$ 1,140.00
500 μg$ 2,460.00
5 μg Enquire
100 μg Enquire
500 μg Enquire
DispatchUsually dispatched within 1-2 weeks
Product Properties
Catalog Numberorb358972
CategoryProteins
DescriptionRecombinant human IL6 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Purity> 96% as determined by SDS-PAGE and HPLC.
Protein SequenceVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM
Protein LengthFull Length of Mature Protein
UniProt IDP05231
MW20.7 kDa
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceE.Coli
Biological OriginHomo sapiens (Human)
Biological ActivityAssay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg. Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 ×106 IU/mg.
Expression Region30-212aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesInterleukin BSF 2 protein, B cell differentiation
Read more...
Research AreaImmunology & Inflammation
NoteFor research use only
Expiration Date6 months from date of receipt.
Images
Human IL6 protein (Active)

Similar Products
  • Recombinant Human Interleukin-6 (IL6) Protein (Active) [orb1881858]

    Greater than 95% as determined by SDS-PAGE

    22.8 kDa

    Yeast

    1 mg, 20 μg, 100 μg
  • Human IL6 protein [orb594784]

    Greater than 95% as determined by SDS-PAGE.

    20.9 kDa

    E.coli

    1 mg, 500 μg, 50 μg, 10 μg
  • Human IL6 protein [orb594722]

    Greater than 95% as determined by SDS-PAGE.

    79.7 kDa

    Mammalian cell

    10 μg, 50 μg, 1 mg, 500 μg
  • Recombinant human IL-6 protein (Active, HEK293) [orb1817202]

    >95% as determined by SDS-PAGE

    26-30 kDa

    10 μg, 500 μg, 50 μg
  • RecombinantIL-6,Human [orb1494814]

    > 95% by SDS-PAGE analysis.

    20.9 kDa, observed by reducing SDS-PAGE.

    Escherichia coli.

    50 μg, 10 μg, 1 mg
Reviews

Human IL6 protein (Active) (orb358972)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet