Cart summary

You have no items in your shopping cart.

Human IL17A & IL17F protein

SKU: orb594824
ActiveBiologically Active

Description

This Human IL17A & IL17F protein spans the amino acid sequence from region 24-155aa & 31-163aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
Heterodimer

Key Properties

SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological Activity①Loaded Biotinylated Human IL-17RA -His-Avi on SA Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 8.6 pM as determined in BLI assay. ②Loaded Biotinylated Human IL-17RA-Fc on Pro A Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 10.3 nM as determined in BLI assay.
TagC-terminal 6xHis-tagged
Molecular Weight15.1kDa & 16.0 kDa
Expression Region24-155aa&31-163aa
Protein LengthHeterodimer
Protein SequenceGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA &RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
PurityGreater than 95% as determined by SDS-PAGE.
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL‑17A/F Heterodimer;IL-17A&IL-17F Heterodimer
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human IL17A & IL17F protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human IL17A & IL17F protein (orb594824)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 310.00
50 μg
$ 870.00
500 μg
$ 3,000.00
1 mg
$ 4,660.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry