You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359210 |
---|---|
Category | Proteins |
Description | Recombinant human IFNA2 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
MW | 19.2 kDa |
UniProt ID | P01563 |
Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 1.0 × 108 IU/mg. |
Expression Region | 24-188aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Alternative names | IFN-alpha-2, LeIF A Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
> 96% as determined by SDS-PAGE and HPLC. | |
19.4 kDa | |
E.Coli |
> 98% as determined by SDS-PAGE and HPLC. | |
19.3 kDa | |
Yeast |
Greater than 95% as determined by SDS-PAGE. | |
19.4 kDa | |
E.coli |