Cart summary

You have no items in your shopping cart.

GLP-2 Antibody Blocking Peptide

SKU: orb72745

Description

This product is GLP-2 Antibody Blocking Peptide. Its protein sequence is HADGSFSDEMNILDNLAADFINWLIQTKITD. It targets Pro-glucagon. Purification is performed using HPLC.

Research Area

Cancer Research, Energy Metabolism, Hormone Research, Metabolism

Images & Validation

Key Properties

TargetPro-glucagon
Protein SequenceHADGSFSDEMNILDNLAADFINWLIQTKITD
PurificationHPLC

Storage & Handling

StorageShipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/AppearanceLyophilized
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Glucagan-like petide; glp-2; GCG; Glicentin; Glicentin related polypeptide; GLP 2; Glucagon like peptide 2; Glucagon precursor; Glucagon preproprotein; GRPP; OXM; OXY; Oxyntomodulin; GLUC_HUMAN.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

GLP-2 Antibody Blocking Peptide (orb72745)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

500 μg
$ 240.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry