CASP1 Rabbit Polyclonal Antibody

• Catalog Number: orb333727
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Caspase 1
• Target: CASP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Rabbit, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP1
• Protein Sequence: Synthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
• UniProt ID: P29466
• MW: 10kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CASP-1 antibody, anti CASP1 antibody, anti Ca
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_001214

Rabbit Anti-CASP1 Antibody, Catalog Number: orb333727, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CASP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, CASP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.