Cart summary

You have no items in your shopping cart.

CASP1 Rabbit Polyclonal Antibody

SKU: orb333727

Description

Rabbit polyclonal antibody to Caspase 1

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityEquine, Rabbit, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CASP1
TargetCASP1
Protein SequenceSynthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
Molecular Weight10kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CASP-1 antibody, anti CASP1 antibody, anti Caspase 1 antibody, anti Caspase-1 subunit p10 antibody, anti ICE antibody, anti IL-1 beta-converting enzyme antibody, anti IL-1BC antibody, anti IL1 beta converting enzyme antibody, anti IL1B convertase antibody, anti Interleukin 1 beta convertase antibody, anti Interleukin 1B converting enzyme antibody, anti Interleukin-1 beta convertase antibody, anti Interleukin-1 beta-converting enzyme antibody, anti p45 antibody

Similar Products

  • Caspase-1 P10 Rabbit Polyclonal Antibody [orb10232]

    FC,  IF,  IHC-Fr,  IHC-P

    Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • Caspase-1 p20 Rabbit Polyclonal Antibody [orb317579]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Caspase-1 p20 Rabbit Polyclonal Antibody [orb221355]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Cleaved-Caspase-1 p20 (D210) rabbit pAb Antibody [orb770550]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • Caspase-1 P10 Rabbit Polyclonal Antibody [orb500778]

    FC,  WB

    Mouse

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CASP1 Rabbit Polyclonal Antibody

Rabbit Anti-CASP1 Antibody, Catalog Number: orb333727, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

CASP1 Rabbit Polyclonal Antibody

WB Suggested Anti-CASP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, CASP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001214

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CASP1 Rabbit Polyclonal Antibody (orb333727)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry